PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc044528.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 129aa    MW: 14672.7 Da    PI: 9.8979
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc044528.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.72.2e-191095291
                     FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89
                              Yn+YA ++ Fsvr+ k+++s   ++ ++++f+Csk+g++++ ++     + +++  rtgC a ++  ++ +g w vtk ++ HnHel
  Itr_sc044528.1_g00001.1 10 VYNDYAFRLDFSVRMGKQRYSAGIKTLKMKEFNCSKSGFKRSLRNG----SYSKVDVRTGCCAFVQFDLDGNGMWTVTKHQKLHNHEL 93
                             7***************************************998776....8999********************************** PP

                     FAR1 90 ap 91
                             +p
  Itr_sc044528.1_g00001.1 94 VP 95
                             86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.8E-161095IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MSSIDEAYEV YNDYAFRLDF SVRMGKQRYS AGIKTLKMKE FNCSKSGFKR SLRNGSYSKV  60
DVRTGCCAFV QFDLDGNGMW TVTKHQKLHN HELVPTTKSY LLQSHRSVST NHLSYLKDLK  120
KSGVSVADG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.15e-14FAR1-related sequence 12